PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G25790.1
Common NameLOC102716887
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 238aa    MW: 26096.2 Da    PI: 7.1823
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G25790.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox598e-1963116356
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k+++++++q+e Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  OB07G25790.1  63 KKRRLSDDQVEMLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 116
                   45589***********************************************99 PP

2HD-ZIP_I/II115.14.2e-3763153292
   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   kkrrls++qv++LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k lE+++++Lk+a+d+   ++++Le+ev +L+e+l 
  OB07G25790.1  63 KKRRLSDDQVEMLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLLEEEFTKLKQAHDSAILHKCHLENEVLRLKERLV 153
                   9**************************************************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.61E-1756117IPR009057Homeodomain-like
PROSITE profilePS5007116.14758118IPR001356Homeobox domain
SMARTSM003896.9E-1761122IPR001356Homeobox domain
CDDcd000864.73E-1563118No hitNo description
PfamPF000464.1E-1663116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.9E-1863116IPR009057Homeodomain-like
PRINTSPR000311.2E-58998IPR000047Helix-turn-helix motif
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PRINTSPR000311.2E-598114IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MDRYGEKQQQ QLFASYEDAS LLVAGSGGAQ EERPRARKRR RRAARCGGGG GGGGEVDGGG  60
DPKKRRLSDD QVEMLELSFR EERKLETGRK VHLAAELGLD PKQVAVWFQN RRARHKSKLL  120
EEEFTKLKQA HDSAILHKCH LENEVLRLKE RLVVAEEEVR RLRSAGTTSH TASAEGGDLV  180
GRGVVCAGSP SSSFSTGTCQ PPGVGGGDHL GDDDLMYVPE YGYADNSVVE WFSLYGLI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13640RKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1218890.0AK121889.1 Oryza sativa Japonica Group cDNA clone:J033105B17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657887.11e-173PREDICTED: homeobox-leucine zipper protein HOX14
SwissprotQ7XI851e-106HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLJ3MME71e-173J3MME7_ORYBR; Uncharacterized protein
STRINGOB07G25790.11e-173(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-31homeobox protein 40